PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00658g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 241aa    MW: 27774.6 Da    PI: 8.6587
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00658g00110.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161966148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT+eEd ll ++++++G g W+ ++ + g++R++k+c++rw++yl
  Peaxi162Scf00658g00110.1 19 KGAWTEEEDVLLRKCIEKFGEGKWHQVPVRAGLNRCRKSCRLRWLNYL 66
                              79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.8571470IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-221769IPR009057Homeodomain-like
SMARTSM007171.7E-141868IPR001005SANT/Myb domain
PfamPF002491.5E-151966IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-212095IPR009057Homeodomain-like
CDDcd001672.54E-102166No hitNo description
PROSITE profilePS500904.12467109IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-67093IPR009057Homeodomain-like
SMARTSM007171871182IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
CDPHIMNTTI PKSSGLVRKG AWTEEEDVLL RKCIEKFGEG KWHQVPVRAG LNRCRKSCRL  60
RWLNYLRPHI KRGDFSPDEV DLILRLHKLL GNRQRKLIAP PRQEIRKCRA LKITENNIVR  120
PRPRTFSNNA QNISWCSNKS ITNSTIDKDG SNNECIRISD KKPMAEVSRD DGVRWWTSLL  180
ANCNENDETA VENMSYDKLP SLLHEEISPT INGGISNCMQ EGKTGWDDFS VDIDHLWNLL  240
N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4281000.0HQ428100.1 Petunia x hybrida cultivar Mitchell PURPLE HAZE gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626596.19e-96PREDICTED: transcription factor MYB90-like
TrEMBLE9LNZ71e-161E9LNZ7_PETHY; R2R3 MYB anthocyanin regulator
STRINGSolyc10g086250.1.13e-81(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-41myb domain protein 113